PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK28510.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 407aa    MW: 47056.8 Da    PI: 6.644
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK28510.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.51.8e-5571361129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeek.ewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                +ppGfrFhPtdeelv++yL+kk+++++++l +vik+vd+yk+ePwdL++  k+ +ee+ ewyfFs++dkky+tg+r+nrat +g+Wkatg+dk+++s k+
  PK28510.1   7 VPPGFRFHPTDEELVDYYLRKKITSRRVDL-DVIKDVDLYKIEPWDLQElcKIGSEEQsEWYFFSHKDKKYPTGTRTNRATVAGFWKATGRDKAIYS-KH 104
                69***************************9.99**************954555554445**************************************.88 PP

        NAM  98 elvglkktLvfykgrapkgektdWvmheyrle 129
                 l+g++ktLvfykgrap+g+k+dW+mheyrle
  PK28510.1 105 DLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                99****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.59E-615156IPR003441NAC domain
PROSITE profilePS5100559.7297156IPR003441NAC domain
PfamPF023653.9E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MNAFSHVPPG FRFHPTDEEL VDYYLRKKIT SRRVDLDVIK DVDLYKIEPW DLQELCKIGS  60
EEQSEWYFFS HKDKKYPTGT RTNRATVAGF WKATGRDKAI YSKHDLIGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETNEN ATPQEEGWVV CRVFKKKIAT TSMRRSEHES PCWYDDQVSF  180
MPDLESPKHH HHHSNSSNVV VSSSNSLPNY QLLHHYYPNC KKEQSPLDHH HHLPYQLLPH  240
DHFLPLLETP KLILHPSTSS APTGLVLNHN NNVVAAFQPS ISLRSSSHDH QSADHHQQQL  300
TLHHDDHQNF HASIAYGNNN NNSSSTTTTT NTTNDLNQQQ GMDDQDDQLT DWRVLDKFVA  360
SQLSHEDNDQ DDDDRVISKG GNVIVRHNWD QKQQEMVPEN NASTSNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-50615714169Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013455347.11e-158transcription factor
SwissprotQ9FWX21e-126NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A072UK041e-158A0A072UK04_MEDTR; Transcription factor
STRINGGLYMA09G36600.11e-149(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF126933106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62700.11e-113Arabidopsis NAC domain containing protein 26